.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wek

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of possible lysine decarboxylases from Thermus thermophilus HB8. Protein Sci. 13 3038-3042 2004
    Site RSGI
    PDB Id 1wek Target Id ttk003001465.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14726, Molecular Weight 24279.64 Da.
    Residues 217 Isoelectric Point 5.57
    Sequence mpkkplidqlhhedswrlfrilaefvegfetlselqvplvsvfgsarfgeghpayeagyrlgralaeag fgvvtgggpgvmeavnrgayeaggvsvglnielpheqkpnpyqthalslryffvrkvlfvryavgfvfl pggfgtldelsevlvllqtekvhrfpvflldrgyweglvrwlaflrdqkavgpedlqlfrltdepeevv qalkaeappr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.20 Rfree 0.25
    Matthews' coefficent 2.55 Rfactor 0.198
    Waters 362 Solvent Content 51.70

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 12
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch