.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wes

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of PHD domain in inhibitor of growth family, member 1-like. To be Published
    Site RSGI
    PDB Id 1wes Target Id mmt007002223.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13470, Molecular Weight 6745.32 Da.
    Residues 58 Isoelectric Point 4.87
    Sequence efaidpneptyclcnqvsygemigcdneqcpiewfhfscvsltykpkgkwycpkcrgd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch