.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wf0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RRM domain in TAR DNA-binding protein-43. To be Published
    Site RSGI
    PDB Id 1wf0 Target Id hss001001277.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13250, Molecular Weight 8416.03 Da.
    Residues 75 Isoelectric Point 4.54
    Sequence vfvgrctgdmtedelreffsqygdvmdvfipkpfrafafvtfaddqiaqslcgedliikgisvhisnae pkhnsn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch