.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wf3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of GTP-binding protein TT1341 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1wf3 Target Id ttk003001341.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14689, Molecular Weight 33807.44 Da.
    Residues 301 Isoelectric Point 5.98
    Sequence maektysgfvaivgkpnvgkstllnnllgvkvapisprpqttrkrlrgiltegrrqivfvdtpglhkpm dalgefmdqevyealadvnavvwvvdlrhpptpedelvaralkplvgkvpillvgnkldaakypeeamk ayhellpeaeprmlsalderqvaelkadllalmpegpffypedyaksdqtfgewvaeilreeamkrlwh evpyavatkveevaerengvlyikailyverpsqkaivigeggrkikeigqatrkqleallgkkvyldl evkvypdwrkdpealrelgyrssvg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.88 Rfree 0.227
    Matthews' coefficent 3.00 Rfactor 0.2
    Waters 178 Solvent Content 59.30

    Ligand Information
    Ligands GNP (PHOSPHOAMINOPHOSPHONIC) x 1;GOL (GLYCEROL) x 2
    Metals MG (MAGNESIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch