.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wf6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The third BRCA1 C-terminus (BRCT) domain of Similar to S.pombe rad4+/cut5+ product. TO BE PUBLISHED
    Site RSGI
    PDB Id 1wf6 Target Id hsk002000252.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12577, Molecular Weight 13543.57 Da.
    Residues 119 Isoelectric Point 5.29
    Sequence sesicnslnskleptlenlenldvsafqapedlldgcriylcgfsgrkldklrrlinsgggvrfnqlne dvthvivgdyddelkqfwnksahrphvvgakwllecfskgymlseepyih
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch