.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wfe

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the 2nd zf-AN1 domain of mouse RIKEN cDNA 2310008M20 protein. To be Published
    Site RSGI
    PDB Id 1wfe Target Id mmt007005089.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13479, Molecular Weight 8425.27 Da.
    Residues 73 Isoelectric Point 8.23
    Sequence csevnvvkerpktdehksyscsfkgctdvelvavicpyceknfclrhrhqsdhdceklevakprmaatq klvr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch