The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structrue of the zf-AN1 domain from Arabidopsis thaliana At2g36320 protein. To be Published
    Site RSGI
    PDB Id 1wfh Target Id atr001000161.1
    Molecular Characteristics
    Source Arabidopsis thaliana
    Alias Ids TPS12229, Molecular Weight 5678.26 Da.
    Residues 51 Isoelectric Point 9.43
    Sequence qpsppqrpnrctvcrkrvgltgfmcrcgttfcgshrypevhgctfdfksag
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch