.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wfi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Nuclear move domain of nuclear distribution gene C homolog. TO BE PUBLISHED
    Site RSGI
    PDB Id 1wfi Target Id mmt007103799.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13595, Molecular Weight 13698.99 Da.
    Residues 118 Isoelectric Point 6.20
    Sequence pnyrwtqtlaeldlavpfrvsfrlkgkdvvvdiqrrhlrvglkgqppvvdgelynevkveesswliedg kvvtvhlekinkmewwnrlvtsdpeintkkinpensklsdldsetrsmv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch