The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title FYVE domain of FYVE domain containing 19 protein from Mus musculus. TO BE PUBLISHED
    Site RSGI
    PDB Id 1wfk Target Id mmt007007399.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13499, Molecular Weight 8348.20 Da.
    Residues 75 Isoelectric Point 9.41
    Sequence mesrcygcavkftlfkkeygckncgrafcngclsfsalvpragntqqkvckqchtiltrgssdnaskws ppqnyk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch