The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The eighth FN3 domain of human sidekick-2. TO BE PUBLISHED
    Site RSGI
    PDB Id 1wfo Target Id hsk002101486.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12772, Molecular Weight 12729.87 Da.
    Residues 117 Isoelectric Point 9.30
    Sequence rigdgspshppilertlddvpgppmgilfpevrttsvrliwqppaapngiilayqithrlntttantat vevlapsarqytatglkpesvylfritaqtrkgwgeaaealvvttekr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch