The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the zf-AN1 domain from Arabiopsis thaliana F5O11.17 protein. To be Published
    Site RSGI
    PDB Id 1wfp Target Id atr001008714.1
    Molecular Characteristics
    Source Arabidopsis thaliana
    Alias Ids TPS12248, Molecular Weight 6482.97 Da.
    Residues 61 Isoelectric Point 8.88
    Sequence trggdsaaapldppkstatrclscnkkvgvtgfkcrcgstfcgthrypeshecqfdfkgva
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch