The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the conserved hypothetical protein TT1886, possibly sterol carrier protein, from Thermus Thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1wfr Target Id ttk003001886.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14816, Molecular Weight 14069.37 Da.
    Residues 130 Isoelectric Point 5.10
    Sequence melfteawaqaycrklneseayrkaastwegslalavrpdpkagfpkgvavvldlwhgacrgakavege aeadfvieadlatwqevlegrleplsalmrgllelkkgtiaalapyaqaaqelvkvareva
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch