.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wfx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the RNA 2'-Phosphotransferase from Aeropyrum pernix K1. J.Mol.Biol. 348 295-305 2005
    Site RSGI
    PDB Id 1wfx Target Id ape001000204.1
    Molecular Characteristics
    Source Aeropyrum pernix
    Alias Ids TPS12097, Molecular Weight 28634.54 Da.
    Residues 256 Isoelectric Point 9.38
    Sequence mpsssqyrryqdphhpsiptpttlfsqpsleilgggvaeelpelalccdgtvvegrsncrckaravlpg gmrvrlsktlagilrhhpgrygvrltregwarvsevveglrkagwswveewhivgvalhdpkgryelrn geiraryghsipvnveplpgepppilyhgtteealplimergimrgrrlkvhltssledavstgrrhgn lvavllvdveclrrrglkvermsktvytvdwvppeciaevrreslgrsl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.286
    Matthews' coefficent 2.40 Rfactor 0.22
    Waters 16 Solvent Content 49.00

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 5;ZN (ZINC) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch