The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of zf-AN1 domain from Arabidopsis thaliana. to be published
    Site RSGI
    PDB Id 1wg2 Target Id atr001009308.1
    Molecular Characteristics
    Source Arabidopsis thaliana
    Alias Ids TPS12250, Molecular Weight 5786.40 Da.
    Residues 51 Isoelectric Point 9.29
    Sequence psrpvrpnnrcfscnkkvgvmgfkckcgstfcgshrypekhecsfdfkevg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch