.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wg3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Similarity between Histone Chaperone Cia1p/Asf1p and DNA-Binding Protein NF-{kappa}B. J.Biochem.(Tokyo) 138 821-829 2005
    Site RSGI
    PDB Id 1wg3 Target Id ar_001000281.1
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS12136, Molecular Weight 19124.55 Da.
    Residues 169 Isoelectric Point 4.46
    Sequence msivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqeldsilvgpvpvgv nkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneydeeelrenppakvqvdhivrn ilaekprvtrfnivwdnenegdlyppeqpgv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.00 Rfree 0.274
    Matthews' coefficent 2.54 Rfactor 0.198
    Waters 119 Solvent Content 51.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch