.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wg4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RRM domain in protein BAB31986. To be Published
    Site RSGI
    PDB Id 1wg4 Target Id mmt007017169.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13568, Molecular Weight 9856.54 Da.
    Residues 85 Isoelectric Point 5.65
    Sequence gpptrrsdfrvlvsglppsgswqdlkdhmreagdvcyadvqkdgmgmveylrkedmeyalrklddtkfr shegetsyirvypers
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch