.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wgb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a probable flavoprotein from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1wgb Target Id ttk003001382.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14712, Molecular Weight 17726.42 Da.
    Residues 159 Isoelectric Point 6.06
    Sequence mnleakkkvlrsftyglyvltakdgdevaagtvnwvtqasfqpplvavglkrdshlhalvertgklalm tlahdqkaiaqdffkptvregdrlnghpfepsptfglplltelpywleaevrhlypggdhslvvaevve agvrreekplvmwdtgwfygg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.2411
    Matthews' coefficent 2.29 Rfactor 0.211
    Waters 129 Solvent Content 46.22

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch