.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wgf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the 4th HMG-box of mouse UBF1. To be Published
    Site RSGI
    PDB Id 1wgf Target Id mmt007011339.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13537, Molecular Weight 8918.74 Da.
    Residues 77 Isoelectric Point 9.92
    Sequence kpsqeggkggsekpkrpvsamfifseekrrqlqeerpelseseltrllarmwndlsekkkakykareaa lkaqserk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch