The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of the N-terminal Ubiquitin-like Domain of Mouse Ubiquitin Specific Protease 14 (USP14). To be Published
    Site RSGI
    PDB Id 1wgg Target Id mmt007007604.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13502, Molecular Weight 9118.16 Da.
    Residues 83 Isoelectric Point 6.44
    Sequence ysvtvkwgkekfegvelntdeppmvfkaqlfaltgvqparqkvmvkggtlkdddwgnikmkngmtvlmm gsadalpeepsakt
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch