The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the cNMP-binding domain from Arabidopsis thaliana cyclic nucleotide-regulated ion channel. To be Published
    Site RSGI
    PDB Id 1wgp Target Id atr001011378.1
    Molecular Characteristics
    Source Arabidopsis thaliana
    Alias Ids TPS12256, Molecular Weight 14077.33 Da.
    Residues 124 Isoelectric Point 5.28
    Sequence vrrvplfenmderlldaicerlkpclfteksylvregdpvnemlfiirgrlesvttdggrsgfynrsll kegdfcgdelltwaldpksgsnlpsstrtvkalteveafaliadelkfvasqfrr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch