.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wgz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of carboxypeptidase 1 from Thermus thermophilus. To be Published
    Site RSGI
    PDB Id 1wgz Target Id ttk003000945.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14496, Molecular Weight 58010.60 Da.
    Residues 510 Isoelectric Point 5.43
    Sequence mtpeaayqnllefqretaylaslgalaawdqrtmipkkghehrarqmaalarllhqrmtdprigewlek vegsplvqdplsdaavnvrewrqayeraraiperlavelaqaeseaesfweearprddwrgflpylkrv yaltkekaevlfalppapgdppygelydalldgyepgmrarellplfaelkeglkglldrilgsgkrpd tsilhrpypveaqrrfalellsacgydleagrldptahpfeiaigpgdvrittryyedffnagifgtlh emghalyeqglpkehwgtprgdavslgvhesqsrtwenlvgrslgfwerffprarevfaslgdvsledf hfavnavepslirveadevtynlhilvrlelelalfrgelspedlpeawaekyrdhlgvapkdykdgvm qdvhwagglfgyfptytlgnlyaaqffqkaeaelgpleprfargefqpfldwtrarihaegsrfrprvl vervtgeapsarpflaylekkyaalyg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.60 Rfree 0.258
    Matthews' coefficent 2.11 Rfactor 0.2143
    Waters 290 Solvent Content 61.50

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals ZN (ZINC) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch