The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the GYF domain of a hypothetical protein from Arabidopsis thaliana. To be Published
    Site RSGI
    PDB Id 1wh2 Target Id atr001006188.2
    Molecular Characteristics
    Source Arabidopsis thaliana
    Alias Ids TPS12243, Molecular Weight 7627.43 Da.
    Residues 65 Isoelectric Point 6.33
    Sequence vrvlsydkeklnwlykdpqglvqgpfsltqlkawsdaeyftkqfrvwmtgesmesavlltdvlrl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch