.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wh3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of C-terminal ubiquitin like domain of human 2'-5'-oligoadenylate synthetase-like protain (p59 OASL). To be Published
    Site RSGI
    PDB Id 1wh3 Target Id hss001000091.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13178, Molecular Weight 8250.01 Da.
    Residues 74 Isoelectric Point 6.29
    Sequence iqvfvknpdggsyayainpnsfilglkqqiedqqglpkkqqqlefqgqvlqdwlglgiygiqdsdtlil skkkg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch