.
The Open Protein Structure Annotation Network
PDB Keyword
.

1whl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the 1st CAP-Gly domain in human cylindromatosis tumor suppressor CYLD. To be Published
    Site RSGI
    PDB Id 1whl Target Id hsk001000012.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12563, Molecular Weight 9035.90 Da.
    Residues 82 Isoelectric Point 4.66
    Sequence idvgcpvkvqlrsgeekfpgvvrfrgpllaertvsgiffgvelleegrgqgftdgvyqgkqlfqcdedc gvfvaldklelie
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch