.
The Open Protein Structure Annotation Network
PDB Keyword
.

1whv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the RNA binding domain from hypothetical protein BAB23382. To be Published
    Site RSGI
    PDB Id 1whv Target Id mmt007011199.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13528, Molecular Weight 10007.81 Da.
    Residues 87 Isoelectric Point 8.90
    Sequence gpdlqpkrdhvlhvtfpkewktsdlyqlfsafgniqiswiddtsafvslsqpeqvqiavntskyaesyr iqtyaeyvgkkqkgkqvk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch