.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wi2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the PDZ domain from RIKEN cDNA 2700099C19. to be published
    Site RSGI
    PDB Id 1wi2 Target Id mmt007003102.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13474, Molecular Weight 10070.09 Da.
    Residues 91 Isoelectric Point 9.30
    Sequence nneltqflprivtlkkppgaqlgfnirggkasqlgifiskvipdsdahraglqegtxvlavndvdfqdi ehskaveilktareismrvrff
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch