The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the first SH3 domain of KIAA0318 protein. To be Published
    Site RSGI
    PDB Id 1wie Target Id hsk002000310.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12579, Molecular Weight 9345.73 Da.
    Residues 83 Isoelectric Point 4.39
    Sequence tskqrysgkvhlcvarysynpfdgpnenpeaelpltagkylyvygdmdedgfyegelldgqrglvpsnf vdfvqdnesrlast
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch