.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wif

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The solution structure of RSGI RUH-020, a PDZ domain of hypothetical protein from mouse. To be Published
    Site RSGI
    PDB Id 1wif Target Id mmt007011942.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13543, Molecular Weight 12236.56 Da.
    Residues 113 Isoelectric Point 9.30
    Sequence sknekeqlskakasvsslnkviqtkltvgnlglglvviqngpylqishlinkgaaasdgilqpgdvlis vghanvlgytlreflkllqnitigtvlqikayrgfleipqewqd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch