.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wii

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RSGI RUH-025, a DUF701 domain from mouse cDNA. To be Published
    Site RSGI
    PDB Id 1wii Target Id mmt007016237.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13564, Molecular Weight 8232.99 Da.
    Residues 72 Isoelectric Point 5.32
    Sequence rkpppkkkmtgtletqftcpfcnhekscdvkmdrarntgvisctvcleefqtpitylsepvdvysdwid ace
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch