The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of the RING Finger Domain of the Human KIAA1045 Protein. To be Published
    Site RSGI
    PDB Id 1wil Target Id hsk002001021.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12630, Molecular Weight 8684.32 Da.
    Residues 76 Isoelectric Point 4.51
    Sequence prepvvndemcdvcevwtaeslfpcrvctrvfhdgclrrmgyiqgdsaaevtemahtetgwschycdni nllltee
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch