.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wim

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of the RING finger Domain of the human UbcM4-interacting Protein 4. To be Published
    Site RSGI
    PDB Id 1wim Target Id hsk002000158.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12575, Molecular Weight 9262.46 Da.
    Residues 81 Isoelectric Point 5.05
    Sequence cklclgeypveqmttiaqcqcifctlclkqyvellikegletaiscpdaacpkqghlqeneiecmvaae imqrykklqfer
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch