.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wj0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the SBP Domain That Lacks the Second Zinc-Binding Site. To be Published
    Site RSGI
    PDB Id 1wj0 Target Id atr001004282.1
    Molecular Characteristics
    Source Arabidopsis thaliana
    Alias Ids TPS12237, Molecular Weight 6626.29 Da.
    Residues 58 Isoelectric Point 7.84
    Sequence aiccqvdncgadlskvkdyhrrhkvceihskattalvggimqrfcqqcsrfhvleefd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch