.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wjg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a probable atp binding protein from thermus themophilus HB8. To be Published
    Site RSGI
    PDB Id 1wjg Target Id ttk003001817.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14799, Molecular Weight 14756.15 Da.
    Residues 137 Isoelectric Point 5.27
    Sequence mfktillaydgseharraaevakaeaeahgarlivvhayepvpdylgepffeealrrrleraegvleea raltgvpkedalllegvpaeailqaaraekadlivmgtrglgalgslflgsqsqrvvaeapcpvllvr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.263
    Matthews' coefficent 2.40 Rfactor 0.247
    Waters 38 Solvent Content 48.69

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch