The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the N-terminal zinc finger domain of mouse cell growth regulating nucleolar protein LYAR. To be Published
    Site RSGI
    PDB Id 1wjv Target Id mmt007015432.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13559, Molecular Weight 7406.09 Da.
    Residues 66 Isoelectric Point 7.52
    Sequence mvfftcnacgesvkkiqvekhvsncrnceclscidcgkdfwgddykshvkcisegqkyggkgyeak
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch