.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wjx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for functional mimicry of long-variable-arm tRNA by transfer-messenger RNA. Proc.Natl.Acad.Sci.Usa 104 8293-8298 2007
    Site RSGI
    PDB Id 1wjx Target Id ttk003000801.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14442, Molecular Weight 14149.70 Da.
    Residues 123 Isoelectric Point 9.72
    Sequence mapvlenrrarhdyeiletyeagialkgtevkslragkvdftgsfarfedgelylenlyiapyekgsya nvdprrkrklllhkhelrrllgkveqkgltlvplkiyfnergyakvllglargk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.229
    Matthews' coefficent 2.70 Rfactor 0.224
    Waters 76 Solvent Content 54.37

    Ligand Information
    Ligands
    Metals K (POTASSIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch