.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wjz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Soluiotn structure of J-domain of mouse DnaJ like protein. To be Published
    Site RSGI
    PDB Id 1wjz Target Id mmk001003857.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13446, Molecular Weight 9450.41 Da.
    Residues 81 Isoelectric Point 5.75
    Sequence maleqtlkkdwysilgadpsanmsdlkqkyqklillyhpdkqsadvpagtmeecmqkfieidqawkilg neetkkkydlqr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch