The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of Fibronectin type III domain derived from human KIAA0970 protein. To be Published
    Site RSGI
    PDB Id 1wk0 Target Id hsk002100947.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12741, Molecular Weight 13565.36 Da.
    Residues 124 Isoelectric Point 4.41
    Sequence deetkafeallsnivkpvasdiqartvvltwsppsslingetdessvpelygyevlisstgkdgkyksv yvgeetnitlndlkpamdyhakvqaeynsikgtpseaeifttlscepdipnppri
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch