.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wk2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein from thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1wk2 Target Id ttk003001768.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14790, Molecular Weight 14435.02 Da.
    Residues 124 Isoelectric Point 9.34
    Sequence mdymerpklglivrepyaslivdgrkvweirrrktrhrgplgivsggrligqadlvgvegpfsveella hqekhlaeeaflrayakdeplyawvlenafryekplhvprrpgrvmfvdlsevrw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.389
    Matthews' coefficent 2.20 Rfactor 0.327
    Waters 45 Solvent Content 44.80

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch