.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wk4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ttk003001606. To be Published
    Site RSGI
    PDB Id 1wk4 Target Id ttk003001606.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14755, Molecular Weight 19577.43 Da.
    Residues 175 Isoelectric Point 7.99
    Sequence mvrirragledlpgvarvlvdtwratyrgvvpeafleglsyegqaerwaqrlktptwpgrlfvaesesg evvgfaafgpdrasgfpgytaelwaiyvlptwqrkglgralfhegarllqaegygrmlvwvlkenpkgr gfyehlggvllgereielggaklwevaygfdlgghkw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.80 Rfree 0.275
    Matthews' coefficent 3.00 Rfactor 0.217
    Waters 114 Solvent Content 58.20

    Ligand Information
    Ligands MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch