The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Basis for Non-cognate Amino Acid Discrimination by the Valyl-tRNA Synthetase Editing Domain. J.Biol.Chem. 280 29937-29945 2005
    Site RSGI
    PDB Id 1wk9 Target Id ttk003000877.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14470, Molecular Weight 16382.78 Da.
    Residues 145 Isoelectric Point 5.44
    Sequence pgklytlryevegggfieiatvrpetvfadqaiavhpederyrhllgkraripltevwipiladpavek dfgtgalkvtpahdpldyeigerhglkpvsvinlegrmegervpealrgldrfearrkavelfreaghl vkeedyt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.247
    Matthews' coefficent 2.88 Rfactor 0.205
    Waters 176 Solvent Content 57.24

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch