.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wkh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Acetylornithine aminotransferase from thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1wkh Target Id ttk003000044.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14203, Molecular Weight 43420.99 Da.
    Residues 395 Isoelectric Point 6.66
    Sequence metrtledwralleaektldsgvynkhdllivrgqgarvwdaegneyidcvggygvanlghgnpevvea vkrqaetlmampqtlptpmrgefyrtltailppelnrvfpvnsgteaneaalkfarahtgrkkfvaamr gfsgrtmgslsvtwepkyrepflplvepvefipyndvealkravdeetaavilepvqgeggvrpatpef lraareitqekgallildeiqtgmgrtgkrfafehfgivpdiltlakalgggvplgaavmreevarsmp kgghgttfggnplamaagvaairylertrlweraaelgpwfmeklraipspkirevrgmglmvglelke kaapyiarlekehrvlalqagptvirflpplviekedlervveavravla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.25 Rfree 0.2434
    Matthews' coefficent 2.00 Rfactor 0.1866
    Waters 271 Solvent Content 38.50

    Ligand Information
    Ligands PPE (4-[(1,3-DICARBOXY-PROPYLAMINO)-METHYL]-3-HYDROXY-2-) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch