The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of Ribosomal Protein L16 from Thermus thermophilus HB8. J.Mol.Biol. 344 1369-1383 2004
    Site RSGI
    PDB Id 1wki Target Id ttk003000816.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14445, Molecular Weight 15962.07 Da.
    Residues 141 Isoelectric Point 10.34
    Sequence mlmprrmkyrkqqrgrlkgatkggdyvafgdyglvalepawitaqqieaarvamvrhfrrggkifirif pdkpytkkplevrmgkgkgnvegyvavvkpgrvmfevagvteeqamealriaghklpiktkivrrdayd eaq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch