The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Nucleoside Diphosphate Kinase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1wkl Target Id ttk003000088.6
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14222, Molecular Weight 15343.09 Da.
    Residues 137 Isoelectric Point 6.92
    Sequence mertfvmikpdgvrrglvgeilarferkgfriaalklmqisqelaerhyaehrekpffpglvrfitsgp vvamvlegpgvvaevrkmmgathpkdalpgtirgdfattidenvihgsatledaqreialffrpeell
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.237
    Matthews' coefficent 3.80 Rfactor 0.217
    Waters 89 Solvent Content 67.00

    Ligand Information
    Metals MG (MAGNESIUM) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch