The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A Novel Induced-fit Reaction Mechanism of Asymmetric Hot Dog Thioesterase PaaI. J.Mol.Biol. 352 212-228 2005
    Site RSGI
    PDB Id 1wlu Target Id ttk003000310.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14326, Molecular Weight 14261.42 Da.
    Residues 136 Isoelectric Point 6.41
    Sequence mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpavalscrmd yfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrlggdgddvpagtgnlaprea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.45 Rfree 0.194
    Matthews' coefficent 4.02 Rfactor 0.188
    Waters 160 Solvent Content 69.20

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals CL (CHLORIDE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch