.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wmg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the UNC5H2 death domain. ACTA CRYSTALLOGR.,SECT.D 62 1502-1509 2006
    Site RSGI
    PDB Id 1wmg Target Id mmt007015810.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13563, Molecular Weight 10013.78 Da.
    Residues 90 Isoelectric Point 4.73
    Sequence yafkiplsirqkicssldapdsrgndwrllaqklsmdrylnyfatkasptgvildlwearqqddgdlns lasaleemgksemlvamatdg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.269
    Matthews' coefficent 2.40 Rfactor 0.229
    Waters 185 Solvent Content 47.90

    Ligand Information
    Ligands SO3 (SULFITE) x 7;SO4 (SULFATE) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch