The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Nucleant-mediated protein crystallization with the application of microporous synthetic zeolites. Acta Crystallogr.,Sect.D 64 686-695 2008
    Site RSGI
    PDB Id 1wmm Target Id pho001001033.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13965, Molecular Weight 17428.74 Da.
    Residues 145 Isoelectric Point 9.79
    Sequence mtywicitnrenwevikrhnvwgvpkkhkntlsrvkpgdklviyvrqekdkegnllepkivgiyevtse pyvdfsrifkphrggketypyrvkikpikigeinfkplindlkfiknkkrwsmhffgkamrelpeedyk lieklll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.248
    Matthews' coefficent 3.20 Rfactor 0.232
    Waters 45 Solvent Content 60.90

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch