.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wn0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the histidine-containing phosphotransfer protein ZmHP2 from maize. Protein Sci. 14 202-208 2005
    Site RSGI
    PDB Id 1wn0 Target Id ar_001000983.1
    Molecular Characteristics
    Source Zea mays
    Alias Ids TPS12227, Molecular Weight 16211.70 Da.
    Residues 145 Isoelectric Point 4.55
    Sequence maaaalreqlnallssmfasglvdeqfqqlqmlqedggtpgfvaevvtlfcddadriiselaalldqpi vdfdkvdayvhqlkgssasvgaqkvkftcmqfrqlcqdknrdgcimalavvrnefydlrnkfqtmlqle qqiqaqq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.248
    Matthews' coefficent 3.49 Rfactor 0.209
    Waters 103 Solvent Content 65.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch