.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wn3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A Novel Induced-fit Reaction Mechanism of Asymmetric Hot Dog Thioesterase PaaI. J.Mol.Biol. 352 212-228 2005
    Site RSGI
    PDB Id 1wn3 Target Id ttk003000310.5
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14329, Molecular Weight 14261.42 Da.
    Residues 136 Isoelectric Point 6.41
    Sequence mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpavalscrmd yfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrlggdgddvpagtgnlaprea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.10 Rfree 0.209
    Matthews' coefficent 1.87 Rfactor 0.18
    Waters 554 Solvent Content 33.60

    Ligand Information
    Ligands HXC (HEXANOYL-COENZYME) x 4;ACT (ACETATE) x 1
    Metals CL (CHLORIDE) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch