The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of PH0066 from Pyrococcus horikoshii. To be Published
    Site RSGI
    PDB Id 1wnf Target Id pho001000066.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13759, Molecular Weight 36234.33 Da.
    Residues 328 Isoelectric Point 6.87
    Sequence mrililgmggtiasvkgergyesalsvskilklagisseakieardlmnvdstliqpsdwerlakeiek evweydgivithgtdtmaysasmlsfmlrnppipivltgsmlpiteknsdapfnlrtalefvklgirgi yiafngkvmlgvraskirsmgfdafesinypnvaeikddklrilhipdfygdeffsdikyepkvlvikl ipglsgdivrealrlgykgiilegygvggipyrgtdlfevvssiskripvvlttqaiydgvdlqrykvg rialeagvipagdmtkeatitklmwilghtknieevkqlmgknitgeltrvs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.251
    Matthews' coefficent 3.30 Rfactor 0.199
    Waters 381 Solvent Content 62.20

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 5



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch