.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wnr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Co-chaperonin Cpn10 from Thermus thermophilus HB8. Proteins 58 498-500 2005
    Site RSGI
    PDB Id 1wnr Target Id ttk003000991.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14503, Molecular Weight 10296.47 Da.
    Residues 94 Isoelectric Point 5.24
    Sequence mikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplevkegdivvfaky ggteieidgeeyvilserdllavlq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.90 Rfree 0.275
    Matthews' coefficent 3.54 Rfactor 0.253
    Waters Solvent Content 65.23

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch